SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56502037|emb|CAH86350.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56502037|emb|CAH86350.1|
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.96e-23
Family Glutathione peroxidase-like 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56502037|emb|CAH86350.1|
Sequence length 114
Comment hypothetical protein PC301962.00.0 [Plasmodium chabaudi chabaudi]
Sequence
FRSIDTHELFKSKRILLISLPGAFTPLCTSKMIPEYEKEYDNFIIENKFDDIYCITNNDI
YVLKSWFKDMGIKKIKYISDGNSSFTESMNMLVDKSNYFMGMRPWRYVAIVENN
Download sequence
Identical sequences Q4X9S3
gi|56502037|emb|CAH86350.1| gi|70914307|ref|XP_731797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]