SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56514202|emb|CAH84378.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|56514202|emb|CAH84378.1|
Domain Number - Region: 52-73
Classification Level Classification E-value
Superfamily RING/U-box 0.0412
Family RING finger domain, C3HC4 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56514202|emb|CAH84378.1|
Sequence length 140
Comment hypothetical protein PC402200.00.0 [Plasmodium chabaudi chabaudi]
Sequence
MANKSEIKPHKVTKDYLSQNIDNGIDTTTVSHNIKLEENKKKFAQKYENKREGKIYETQC
NNSFHFNCLLSFFIVIFLFYNISTELIRIINNSLVENITNDDLKFPFQNRKQNTDHSIEE
HIEDQHSYYEYANSLYQYYG
Download sequence
Identical sequences A0A077YES6 Q4XFE0
XP_738191.1.12432 PCAS_103500 gi|56514202|emb|CAH84378.1| gi|70933714|ref|XP_738191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]