SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56526001|emb|CAH78013.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56526001|emb|CAH78013.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.32e-22
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 2 Region: 667-756
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000034
Family Staphylococcal nuclease 0.0075
Further Details:      
 
Domain Number 3 Region: 803-900
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000246
Family Tudor domain 0.0045
Further Details:      
 
Domain Number 4 Region: 363-458,509-558
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000418
Family Staphylococcal nuclease 0.0089
Further Details:      
 
Domain Number 5 Region: 165-187,236-353
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000641
Family Staphylococcal nuclease 0.02
Further Details:      
 
Domain Number 6 Region: 852-1001
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000128
Family Staphylococcal nuclease 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56526001|emb|CAH78013.1|
Sequence length 1005
Comment conserved hypothetical protein [Plasmodium chabaudi chabaudi]
Sequence
MERLIGVVKQVISADTYILLGPKKNGIAQERQISLAWIQCPKLYVKSQTSEKNEEPFAWE
SRELIRKLIIGKSVSFTLEYVYNNRQYCSVYFEDTNLSILLLEKGYANLVFNKSVKTNVY
SDLEPYYLEAKNKNLGIFGNNINKYVRNIININNDKNENKKIYDMLANKKVHCVIEHVRD
GGHLRVYAQLEKKENKEEGNKKNNVKNENKKNEKGGKGSKKKHEDNNTNEPEEKYLTMYY
FSISLCGIIVDMYKKEVINNVETVKEETYATETKKFVEYRLLNRDVEIEIRHIDNNLNLY
GNIHYKLGNICLLLLKNGYAYINDYTIKYVENPIEYKRALDEAVKLRKKKWINYSEKEVD
FEKEYITTVIEVLYGDIIIVDYKNEERRLYLSSIKCEKHNSDIHLNTLSLLAKDYLKKKI
VGEQVKIITECVKIPQSNNEGYIPPCSDNKGRMHFVSVYQITKKQVDKKGSLPGSNKINS
EKKKKGKKSNSNSKDDKKNESENMDQEDYNEMSLNEELVAEGLAKVVNYVQENEKPNYYF
NLQALEKESEKKKLGRFNPHLDIIKINNISGSENALRARSFENTLNKYNNLNAXCIIYXG
ANKYKIYIPSQNLMINFILLGVNIQKINLKEIGNDNVNKNGNIENAKREDDYVSADAGKK
NNKKEKSEYRDIAIQAYKYVRKLLMQRSVQICIITCDKGGNFIGTLKYQNKDIAHHLLSL
GYGMLNDIGLKNITERANYIKAAEEAKNNKRNIWAIEIVNENNENGLLNGDKAKLSEFDN
IYYCSYVDDINNICLQLKNKQDQLKKFQEDINKKSYIESIPEMSINNISKNALVLAKYID
NYYYRAVVLQINKSKNKCTVKYIDFGNEDEINMADVKKLTPEYSLKNYHQFAIKVALSGL
KMPEDNKPDLMIYIKQLLLDKFLYVKFEKKVENIYHVVFYDYEQFTTNKNVKSVNEEIAN
QGICYVDNFSDTKIFEKLKKEELQSKKNKLGIWSYGDINYDDTYA
Download sequence
Identical sequences Q4XYJ7
gi|56526001|emb|CAH78013.1| gi|70952978|ref|XP_745620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]