SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66362090|ref|XP_628009.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66362090|ref|XP_628009.1|
Domain Number 1 Region: 425-491
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000465
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|66362090|ref|XP_628009.1|
Domain Number - Region: 499-560
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000162
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66362090|ref|XP_628009.1|
Sequence length 660
Comment PHD finger containing protein [Cryptosporidium parvum Iowa II]
Sequence
MFINILNTSQNNKETVADIRTINEVEKDFLGNSIFQGCTQTSDYIFNTQEKFNSNLLEKA
NNSNDYNNHNNSASPVDELGNQNCISLEALKGKMSQDVTFDSDFKNKSKNNLDLNWQEGK
VSIKKGKIKVECNYAFTPTKSSLRVRCIYCKKIYFSVKGFISHRGRCIYYKAFQNTQYES
ISQNCKNSNSNKYLSNSKEKSLQNNQILNSLVDTQYTENSQYNSKINSGFQSSTNEDTTL
FNYNSDNRFHFDDKEMDHLSTYNTLRKVINGNNHIFELEKSSNLNSNKSESSKNSNGKIE
NTSFYNDKIDVENFKMYLYAAISCLPKYIVAKILKRRNPGISISIDEKSEDITKEELIDM
IFAGIGQKVLQNNSDLKGETNEKLLEQKNLLNNLRCDKTEKIELELESIKSESNSINNDI
KDENFQLNIPVFFRHSLPKDSEWKCYICKVPRNGKESMNMCVNCGYIYHLTCQSQANKIT
KNDWFCDYCKAHGNKLKPGSKFQIGELVWVNYKCTFWPAQIMEFSKEQFEVFIFHIEKRI
EKSSNEILPWSKGIISIDGLASKGTFVRESTSSIMHWQSVYKAIKYYLNSLRSKQRRLPQ
IKKKNSSNEFKIDNKKKKTDVMVSNNSNSETRVFHPIPSGINDGLEQHSNEISLLDVSSH
Download sequence
Identical sequences Q5CSQ8
gi|46227492|gb|EAK88427.1| gi|66362090|ref|XP_628009.1| gb|cgd1_1690 5807.cgd1_1690 XP_628009.1.25317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]