SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66362764|ref|XP_628348.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66362764|ref|XP_628348.1|
Domain Number 1 Region: 104-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-55
Family RecA protein-like (ATPase-domain) 0.000000236
Further Details:      
 
Domain Number 2 Region: 21-83
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000188
Family DNA repair protein Rad51, N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66362764|ref|XP_628348.1|
Sequence length 342
Comment meiotic recombination protein DMC1-like protein [Cryptosporidium parvum Iowa II]
Sequence
MSAFCQSKSVAKQVSAKGVEEEAFVEIDKLQSAGINVADINKLKTAGLCTVLSIIQATKK
ELCNIKGLSEAKVEKIVEAAQKLDQSSSFQSGSEVMSRRQNILRITTGSEQFDKMLMGGF
ESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFIDTEGTFRPERIVKIAER
FGVQGDVALDNIMYARAYTHEHLNQLISAAAGKMIEEKFALLIVDSIIALFRTEFSGRGE
LAERQQILNKTLSKLNKLADQFNIAIVMTNHVMADPAGGMSFMPNVAKPVGGHVIGHASH
VRLSLRKGKGEQRVCKVYGSPHLPESECVIQLSDGGIIDPID
Download sequence
Identical sequences Q5CYN2
5807.cgd7_1690 gb|cgd7_1690 gi|46229395|gb|EAK90213.1| gi|66362764|ref|XP_628348.1| XP_628348.1.25317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]