SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67474196|ref|XP_652847.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67474196|ref|XP_652847.1|
Domain Number 1 Region: 27-160
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.01e-17
Family Staphylococcal nuclease 0.0083
Further Details:      
 
Domain Number 2 Region: 713-855
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000131
Family Staphylococcal nuclease 0.0067
Further Details:      
 
Domain Number 3 Region: 182-321
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000288
Family Staphylococcal nuclease 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|67474196|ref|XP_652847.1|
Domain Number - Region: 494-598
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000183
Family Staphylococcal nuclease 0.02
Further Details:      
 
Domain Number - Region: 357-457
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000248
Family Staphylococcal nuclease 0.0083
Further Details:      
 
Domain Number - Region: 676-745
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000361
Family Tudor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67474196|ref|XP_652847.1|
Sequence length 861
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MPAQNTQKKDLSKKVEKKPESEPKKEKKTFTAFVAKVKSNNSLTLSSKKDDKRSTVVLAY
VDLPRYDAKEKKEEAFAYETNEILRKKLVTGKEVKFEVVSEHQGIPKAVVPFVRKENIVC
TLIESGYASLKIKGKGKEFSQYFDAEQKAKDSHRGIFSEDMIKIAKKRPENIFFNEKEIS
ELKGKTIQGHIKRVEAPSHYIIEDTNRRRFKVVLYGVNQMLRYNTEKDVFDFDDDAKDAM
KYINRSFNQRDVTVKVIETSQRVAYAQLSVEKKDVAEELLRSGFVVCSKLENATEEIKQK
YQAAEKEAKKEKKARWTEFDQAAEDAIIAKRQQRLKELEDRRKNAKIISGAEIIYIGNHI
KAKKGNEEYNIHLASVRPVFKKNDKEFNDLVQFRIKECLRKLIVGKKFEAKECYKRSFTK
EDKTIEEVFYDVYASGKNVAVTLIKEGLVVLEKTRDEFYQSFDYKLLSETPKGEYKEKVV
TQYPAEKRESIKDVFLNNSFNCIVERVINVCKYVIYIPEKDCRMTVVLSHCRIPRDDENE
ELKKFNEESKAAVRALFGLNEVTVDFREFFKGNFCVDILSKKFDLCDLVLSKAYAQFSGR
DIPENIAEMKENQEGIYKFAGAKKEGESKPVRPVKVVKEVHREIKFGEGKNVYITGFDGS
MIYYYEKVADAKFIEELSNKLKKCNKGSVEQKDGQKCVVEIKGVQYRAIITKAVPTANVV
KCIDTGAVIVCGKNKLKPLKEEYENIEVTVKSIALAGVKTLVRGKDVDFDAMINAVSSFF
NKEATMFVATINDKEVAKVVVGDVCINNMLIEEGLSILDRFFNDNSDWGRAMTSAQSAAK
DKHLNVWRYGEIDDDEEKDKH
Download sequence
Identical sequences A0A175JM50 C4M0A8 M2RBS8 M3V060 N9TAH0
XP_652847.1.49425 gi|56469738|gb|EAL47459.1| gi|67474196|ref|XP_652847.1| jCVI|EHI_005150 294381.C4M0A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]