SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67477127|ref|XP_654076.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67477127|ref|XP_654076.1|
Domain Number 1 Region: 125-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.83e-61
Family RecA protein-like (ATPase-domain) 0.0000000169
Further Details:      
 
Domain Number 2 Region: 42-108
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000011
Family DNA repair protein Rad51, N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|67477127|ref|XP_654076.1|
Sequence length 366
Comment DNA repair protein RAD51 [Entamoeba histolytica HM-1:IMSS]
Sequence
MSAKQIQRGSEEELLESEENLKEKEKVNEEEHEEEEEEEEEEENAAVPIRKLIGLAGITE
GDCKKLEEAGFFTVQSIAFTPKKQLITIKGISDAKADKLLAESSKIVPLAFTNAAELNNL
RKETIRITTGSRELDKLLCGGFETGSITELFGEFRTGKTQLCHQLCVTCQLGIENGGTEG
RAIYIDTEGTFRPERLTQIAEKYGLNSEEALNNVAVARAHNTEHQMQLLQMASGLMAKER
YGLLIIDSATALYRTDYSGRGELASRQMHLAKFLRALQRIADEFSVAVVLTNQVVAQVDG
QASMFGGDTKKPVGGNIIAHASTTRLYLRKGKGEARICKVYDSPCLPESEASFAITTNGI
EDVKDD
Download sequence
Identical sequences A0A175JRL3 C4M4K4 M2RJJ9 M3S8G3 N9URX4
294381.C4M4K4 EnhiA.01020.a XP_654076.1.49425 jCVI|EHI_031220 gi|56471096|gb|EAL48690.1| gi|67477127|ref|XP_654076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]