SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67482461|ref|XP_656580.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67482461|ref|XP_656580.1|
Domain Number 1 Region: 107-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.1e-58
Family RecA protein-like (ATPase-domain) 0.0000000645
Further Details:      
 
Domain Number 2 Region: 28-90
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000235
Family DNA repair protein Rad51, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67482461|ref|XP_656580.1|
Sequence length 347
Comment Meiotic recombination protein DMC1 [Entamoeba histolytica HM-1:IMSS]
Sequence
MTEVKSKTNEQEENVQEIEEDEVEEVPSFHSIDILQQQGINVGDINKLKSAGCNTIESVV
MHTHKELCAIRGFSDSKVDKIMEAVSKIFPTHSFISATTSLERRANVIKITTGSSQFDQL
LGGGIETMSVTEMFGEFRTGKTQLCHTLAVTTQLPSHLKGGNGKVAYIDTEGTFRPERIA
QIAERFGVDQTAVLDNILIARAYTHEQQFDLLIEVAARMAEDHFRMLIIDSVTSLFRVDF
SGRGELSERQQKLGKMMNKLIKISEEFNVAVVITNQVMSDPGGGAMFVVDPKKPIGGHVI
AHASTTRLYLRKGKGEQRIVKIYDSPNLPEAEATFAIDTGGIIDAKD
Download sequence
Identical sequences A0A175JF07 C4LTR6 M2Q6A3 M3S952 M7W6Y8 N9V7D2
EnhiA.00351.a jCVI|EHI_050430 gi|56473788|gb|EAL51192.1| gi|67482461|ref|XP_656580.1| XP_656580.1.49425 294381.C4LTR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]