SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67586590|ref|XP_665199.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67586590|ref|XP_665199.1|
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000199
Family PHD domain 0.034
Further Details:      
 
Domain Number 2 Region: 42-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000235
Family PWWP domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67586590|ref|XP_665199.1|
Sequence length 203
Comment hypothetical protein [Cryptosporidium hominis TU502]
Sequence
MNMCVNCGYIYHLTCQSQANKITKNDWFCDYCKTHGNKLKPGSKFQIGELVWVNYKCTFW
PAQIIEFSKEQFEVFIFHIEKRIEKSSNEILPWSKGIISIDGLASKGTFVRESTSSIMHW
QSVYKAIKYYLNSLRSKQRRLPQIKKKNSSNEFKIDKKKKKIDIMVSNNSNSETRVFHPI
PSEINDGLEQHSNEISLLDVLSN
Download sequence
Identical sequences 237895.Q5CED7 gi|67586590|ref|XP_665199.1| Chro.10194 XP_665199.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]