SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67594825|ref|XP_665902.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67594825|ref|XP_665902.1|
Domain Number 1 Region: 107-342
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-61
Family RecA protein-like (ATPase-domain) 0.0000000303
Further Details:      
 
Domain Number 2 Region: 37-92
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000518
Family DNA repair protein Rad51, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67594825|ref|XP_665902.1|
Sequence length 347
Comment Rad51 [Cryptosporidium hominis TU502]
Sequence
MSTINPNEVVNENNENQNNLNETVYNGPLKLEHLLPSGLTKRDLEILRENGYHTIECLAY
APKKALLSVKGISEQKCDKIKSACKELVAMGFCSGTEYLEARTNLIKFTTGSSQLDRLLQ
GGIETGSITEIFGEFRTGKTQLCHTLAVTCQLPVEHKGGEGKCLWIDTEGTFRPERIVQI
ADRFNLNASDCLDNIAYARGFNTEHQMDLLQSAVAMMTESRFALMIVDSATALYRSEYNG
RGELATRQSHLGQFLRALQKIADTFGVAVVITNQVMSKVDAMAAMFQNDKVPIGGNIIAH
ASQTRLFLKKGRGETRICKIYDSPNLPEGDATFSITEGGINDPKDEK
Download sequence
Identical sequences A0A0S4TFX6
gi|67594825|ref|XP_665902.1| Chro.50352 237895.Q5CGE0 XP_665902.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]