SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67608878|ref|XP_666912.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67608878|ref|XP_666912.1|
Domain Number 1 Region: 37-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67608878|ref|XP_666912.1|
Sequence length 137
Comment TSP1 domain-containing protein TSP9 precursor [Cryptosporidium hominis TU502]
Sequence
MRYRIILAQSDLGGVQCPTEKEITERASCQLQECEKSCSTGEICKNGGTCIDIPNSGFSC
ECAEDYFGKFCEHKKYSWWVYFVVCIATQIIIGAIVKSTFLSRPAPITETPVTYNQEYAF
NDYPTAFDQNTDISGVF
Download sequence
Identical sequences 237895.Q5CJ94 XP_666912.1.74355 gi|67608878|ref|XP_666912.1| Chro.60104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]