SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68005564|ref|XP_670067.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68005564|ref|XP_670067.1|
Domain Number 1 Region: 25-87
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000022
Family DNA repair protein Rad51, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68005564|ref|XP_670067.1|
Sequence length 114
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MATLPSSKSASKVALTTNVEEITKEQQFQGIEKLQDLGINAADINKLKGSGYCTILSLIQ
ATKKELCNVKGISEVKVDKILEVASKIENCSAFITGNQLVQKRSKVLKITTESS
Download sequence
Identical sequences Q4YD80
XP_670067.1.11252 gi|68005564|ref|XP_670067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]