SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68009911|ref|XP_670536.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68009911|ref|XP_670536.1|
Domain Number 1 Region: 41-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000314
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68009911|ref|XP_670536.1|
Sequence length 124
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MIVNYENKGQIYNDITKSTWYAKNKENLNKAKYLEIDSFSVIIDWINSLLISNNILNGYN
LYEEIKDGVIILKLIQIYNPEIEIRGIFLKALKKKCAMKNLEKALSIIYMNNPYYYSMVS
STDI
Download sequence
Identical sequences Q4YME9
gi|68009911|ref|XP_670536.1| XP_670536.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]