SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68071341|ref|XP_677584.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68071341|ref|XP_677584.1|
Domain Number 1 Region: 110-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.23e-59
Family RecA protein-like (ATPase-domain) 0.0000000218
Further Details:      
 
Domain Number 2 Region: 40-95
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000801
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68071341|ref|XP_677584.1|
Sequence length 349
Comment Rad51 [Plasmodium berghei strain ANKA]
Sequence
MKSANAKEDTISQTCDNSTTEEVDEHLYAGPLKIEQLLAKGFVKRDLELLKEGGLQTVEC
VAYAPMRTLCSIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQLDA
LLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPERI
VAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADTRFALLIVDSATALYRSE
YTGRGELANRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKIPIGGNI
IAHASQTRLYLRKGRGESRICKIYDSPVLPEGEAVFAITEGGIADYEEK
Download sequence
Identical sequences A0A077XG51 A0A0Y9WU76 Q4Z3S5
PBANKA_093950 gi|68071341|ref|XP_677584.1| XP_677584.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]