SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68073129|ref|XP_678479.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68073129|ref|XP_678479.1|
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-19
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 2 Region: 594-642,678-763
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.4e-17
Family Staphylococcal nuclease 0.007
Further Details:      
 
Domain Number 3 Region: 811-907
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000384
Family Tudor domain 0.0053
Further Details:      
 
Domain Number 4 Region: 362-446,516-565
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000222
Family Staphylococcal nuclease 0.0089
Further Details:      
 
Domain Number 5 Region: 859-1008
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000157
Family Staphylococcal nuclease 0.0029
Further Details:      
 
Domain Number 6 Region: 164-186,235-352
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000275
Family Staphylococcal nuclease 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68073129|ref|XP_678479.1|
Sequence length 1012
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MERLIGVVKQVISADTYVLLGPKKNGIAQERQVSLACIQCPKLYVKSQTLEKNEEPFAWE
SRELIRKMIIGKNVSFTLEYVYNNRQYCSVYFETNLSILLLEKGYANLVFNKNVKTNVYA
DLEPYYLEAQNKNLGIFGNNINNFVRNIININNDKNENKKIYDTLVNKKVHCVIEHVRDG
GHLRVYAQLEKNENKDEGNKKNNVKNESKKNGKGGKGAKKKHEDNTINQTGEKYLTMYYF
SISLCGIIVDMYKKEVINNVETIKEETYATETKKFVEYRLLNRDVEIEIKHIDNNLNLYG
NIYYKLGNICLLLLKNGYAYINDYTIKYVENPLEYKKALDEAVKLRKKKWINYSEKEVDF
EKEYITTVIEVLYGDIIIVDYKNEERRLYLSSIKCEKHNSDIHLNTLSLLAKDYLKKKIV
GEQVKIVTECVKTPQSNNEGYIPPCSDNKGRMHFVSVYQIKKKQVDKKGNVPISNKINSE
IADKDNSGKKKKGKKSNNNTKDDKKNESENMDQENYNEISLNEELVAEGLAKVVNYVQEN
EKPNYYFNLQALEKESEKKKLGRFNPHLDIIKINNISGSENALRARSFENTLNKYNNLNA
YVDYIYGANKYKIYIPSQNLMINFILLGVNIQKINLKEIGNENVNKNGNIENAKREDDYV
VGDAGKKNKKKEKSEYKDIAIQAYKYVRKLLMQRAVQICIITCDKGGNFIGTLKYQNKDI
AQHLLSLGYGMLNDIGLKNITERSNYIKATEEAKNNKRNIWAIEIVNENTENSPINGDKA
KLSEFDNIYYCSYVDDINNICLQLKNKQDQLKKFQEDINKKSYIESIPEISINNINKNTL
VLAKYIDNYYYRAVILQINKSKNKCIVKYIDFGNEDEISFADIKKLTPEYSLKNYHQFAI
KVALSGLKMPEDNKPDLMIYIKQLLLDKFLYVKFEKKTENIYHVVFYDYEQFTTNKNVKS
VNEEMANQGICYVDNFSDTKIFEKLKKEELQSKKNKLGIWSYGDINYDDNYA
Download sequence
Identical sequences Q4YSM6
gi|68073129|ref|XP_678479.1| XP_678479.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]