SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68224094|emb|CAJ04204.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68224094|emb|CAJ04204.1|
Domain Number 1 Region: 382-460
Classification Level Classification E-value
Superfamily YaeB-like 2.35e-32
Family YaeB-like 0.00048
Further Details:      
 
Domain Number 2 Region: 237-301
Classification Level Classification E-value
Superfamily YaeB-like 0.000000445
Family YaeB-like 0.0035
Further Details:      
 
Domain Number 3 Region: 56-86
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000015
Family PWWP domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68224094|emb|CAJ04204.1|
Sequence length 488
Comment hypothetical protein, conserved [Leishmania major strain Friedlin]
Sequence
MSVTPLSPFLQAAVTSVSPPTSATPADTVAGSTAPAAERVVRDGVSKRYRVRANYFLVGD
LVWVRPAKLPYWPAVVADCDEAANRVRARLIVPPPAAVLAANLAEEQRKYRRREEARLGK
MHKKKAEPASSTATGNEASIVHGQSSPLGLGVDSGTLSASGGAAPAPPEPQSDVVTANGQ
VVYFFDKLRTTEELDVCLENRLQRNKHDVTLYEDAFTQAVLQANRLARISLSPEKLQPYE
VCAVGIVHSLMRAHIEAPRQPNTGTFEPQTGLIRLRTGLENAARDLAGFEFIWVLFQFSF
AAPMASGEGQESMRKFREAREASASATTKPALAVPDSVPATAEKASPTADGHVDVCRDSD
GEALSAWSLSSFRRRQGFDRAAGFKTMIIPPRDEEWRGVFATRSPHRPNFIGLSCVRLVA
VHGLDIHIADHDLLHGTPVLDIKPYLPYCDAHPDARAGWVEVLDASGKGKGDHKYDRQTT
QVHRVSLE
Download sequence
Identical sequences Q4QBT8
psu|LmjF22.0590 gi|157869317|ref|XP_001683210.1| gi|68224094|emb|CAJ04204.1| XP_001683210.1.98313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]