SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68532056|ref|XP_723703.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68532056|ref|XP_723703.1|
Domain Number 1 Region: 168-213
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000241
Family Tudor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68532056|ref|XP_723703.1|
Sequence length 321
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MDEFNESLEDLEEKINEYNKQLALVRDEIKKYEQIQNDQNEENEQIQNLKKLECDMIEVI
NLTRDLIKYKKKNESDDEIPNQIAEENEQPFSNENENVMNESELLVGRTCSFMYENKRVY
GSIENVVIQNNMEQLLVHVFETNEQVLVQKNYVQLNEILHTLPTSENNQFQALYKKDGQW
YDCMVSKNKGDSYLITYIGYNNSEYVKNDQIRIKKKKKIKEVITPAGYKIPENLIIKEND
SLKTKLKKTKKRNALKKKQKNELINKEFANKTQQWKSVHEKAISKSKHLLIAHKKTENIE
YTNNPANINIRRKFDYKDNED
Download sequence
Identical sequences A0A078KAD7 Q7RSJ7
73239.Q7RSJ7 gi|68532056|ref|XP_723703.1| 103.m00098|PY00358|PY00358|hypothetical XP_723703.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]