SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70906072|gb|AAZ14711.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70906072|gb|AAZ14711.1|
Domain Number 1 Region: 125-361
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-56
Family RecA protein-like (ATPase-domain) 0.0000000568
Further Details:      
 
Domain Number 2 Region: 50-110
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000549
Family DNA repair protein Rad51, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70906072|gb|AAZ14711.1|
Sequence length 364
Comment RAD51/dmc1 protein [Leishmania major strain Friedlin]
Sequence
MQQQQQQQRQHSSHFAEERVGDRGAAFAEPQPLHNSVTGEAAGQSLLEVERLAEHGIGAA
DITKLKQAGIFTVPGVQMQCRKDLIQIKGLSEAKVDKIIEAARRVSEVGFITGSSCLQQR
STLLRISTGSTALDQLLGGGGIESRSITEAFGEFRTGKTQIGHTLCVTCQLPLEMGGGNG
KAVYVDTEGTFRPERIRPIAERFGMDSNSVLDNILVARAYTHEHQAHLLSMVAAKMAEDQ
FSLLVVDSITALFRVDFSGRGELAERQQKLAKMLSQLIKIAEEFNIAVYITNQVVSDPGG
ASMFVADPKKPVGGHILAHASTTRLSLRKGRGDQRVCKIFDSPSLPELECVYSISEQGII
DAVE
Download sequence
Identical sequences O61128
gi|70906072|gb|AAZ14711.1| gi|72549845|ref|XP_843593.1| XP_003722884.1.98313 psu|LmjF35.4890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]