SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70929688|ref|XP_736866.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70929688|ref|XP_736866.1|
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-28
Family Thioltransferase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70929688|ref|XP_736866.1|
Sequence length 109
Comment hypothetical protein [Plasmodium chabaudi chabaudi]
Sequence
DFEKTEIYQDLKTKIKDILEKEKIVLFMKGTPEQPLCGFSASVVQILNKVNVKDYVYIDV
MKNRNLREAIKIYSNWPYIPHLYVKNNFIGGCDIVSDLYNKGELETIVK
Download sequence
Identical sequences Q4XGU5
gi|56511771|emb|CAH83872.1| gi|70929688|ref|XP_736866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]