SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|70939108|ref|XP_740140.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70939108|ref|XP_740140.1|
Domain Number 1 Region: 110-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-52
Family RecA protein-like (ATPase-domain) 0.0000000483
Further Details:      
 
Domain Number 2 Region: 40-95
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000706
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|70939108|ref|XP_740140.1|
Sequence length 324
Comment Rad51 [Plasmodium chabaudi chabaudi]
Sequence
MKSANAKEDTVSQTCDNSTIEDADEHLYAGPLKIEQLLAKGFVKRDLELLKEGGLQTVEC
VAYAPMRTLCSIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQLDA
LLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRPERI
VAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADTRFALLIVDSATALYRSE
YTGRGELANRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKLPIGGNI
IAHASQTRLYLRKGRGESRICKIY
Download sequence
Identical sequences Q4Y3A0
gi|56517647|emb|CAH76360.1| gi|70939108|ref|XP_740140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]