SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71029384|ref|XP_764335.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71029384|ref|XP_764335.1|
Domain Number 1 Region: 143-191
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000802
Family Tudor domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|71029384|ref|XP_764335.1|
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0345
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71029384|ref|XP_764335.1|
Sequence length 192
Comment hypothetical protein [Theileria parva strain Muguga]
Sequence
MDEAETIEDLKVNLDEYHKQLSTVEDSLKQDPENQELISLKRDLNEVIILTNDLIKYKQS
NEELLKQGVIHLEDIKDVDITTSIFIGRTCVVLYNGKQKYGEVVQVMGDQPNDLTIIELL
GSREKCTLCLKDLRLLEPPLPAQCKPGSLVQALYAEDGRWYDCIINRQTEKGYIVTYKDY
NTSEEVQRDRVS
Download sequence
Identical sequences Q4N1N3
529.m03971 gi|71029384|ref|XP_764335.1| XP_764335.1.6148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]