SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71409616|ref|XP_807143.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71409616|ref|XP_807143.1|
Domain Number 1 Region: 132-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.5e-56
Family RecA protein-like (ATPase-domain) 0.0000000171
Further Details:      
 
Domain Number 2 Region: 52-116
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000235
Family DNA repair protein Rad51, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71409616|ref|XP_807143.1|
Sequence length 371
Comment DNA repair protein RAD51 [Trypanosoma cruzi strain CL Brener]
Sequence
MNTRSKRGKRKGVEEVEVHEIANTSPDPVAAPEQQQQQQEDQQNVDGANNGGFRVIQVLE
SYGIASADIKKLMESGFYTVESVAYAPKKNILAVKGISETKADKIMAECAKLVPMGFTSA
VVYHEARKEIIMVTTGSREVDKLLGGGIETGGITELFGEFRTGKTQLCHTLCVTCQLPIS
QGGAEGMALYIDTEGTFRPERLVAVAERYKLDPQDVLSNVACARAFNTDHQQQLLLQASA
MMAENRFAIIIVDSATALYRTDYSGRNELAARQMHLGKFLRSLHNLAEEYGVAVVVTNQV
VANVDGSAQMFQADAKKPIGGHIMAHASTTRLSLRKGRGEQRIMKVYDSPCLAEAEAIFG
IYEDGVGDARD
Download sequence
Identical sequences Q4CYE3 V5BKV4
psu|Tc00.1047053503801.30 gi|71409616|ref|XP_807143.1| gi|71652370|ref|XP_814843.1| XP_807143.1.87722 XP_814843.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]