SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71419048|ref|XP_811051.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71419048|ref|XP_811051.1|
Domain Number 1 Region: 179-239,271-353
Classification Level Classification E-value
Superfamily YaeB-like 2.48e-41
Family YaeB-like 0.00019
Further Details:      
 
Domain Number 2 Region: 56-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000511
Family PWWP domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71419048|ref|XP_811051.1|
Sequence length 380
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MVVMEQKDAVGPRSPGSGRIPRRGSSEDDDGDGVVGTVKSKNQAERNRPMRLGVRPHYFL
PGDIVWVRPAALPYWPAEVVQAEVSTNSITARLFDPPALLSLQADGNFSRDHVTVSATKV
FFFDRLSTPEEVEVCIEQRLQRTTHNVSAYEADFQRAVLHANRLVRIVLSPEKLQPRLIC
GVGVVHSLMRTHISAPRQPHTTNFTPQTAVIKLRVGLENAVRDLRGFEFIWVLFLFSYAT
DADETGDANGPGVLDALQGGAQRRRRQGAENSAGFKTMLVPPRDSQLRGVFATRSPHRPN
FIGISCVRLVAVQGLEVHIADHDLLHGTPVLDIKPYLPYCDAHPNAKAGWVEELENSGRV
GADHKYDMQRMQVDRIFEDE
Download sequence
Identical sequences Q4D9I9
psu|Tc00.1047053506857.110 XP_811051.1.87722 gi|71419048|ref|XP_811051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]