SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71424226|ref|XP_812723.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71424226|ref|XP_812723.1|
Domain Number 1 Region: 424-475
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000125
Family Transcriptional factor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 180-257
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000654
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0032
Further Details:      
 
Domain Number 3 Region: 7-96
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000295
Family PWWP domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71424226|ref|XP_812723.1|
Sequence length 477
Comment transcription elongation factor-like protein [Trypanosoma cruzi strain CL Brener]
Sequence
MVPYPVYEPFDRVWVKMEGYDWWPARIVSDEELRANGQSRAEGCDITVYFYEGTTTPASL
EHFKSATTSITFFETSSEKAVTADADLLAAIRRAETDETANPLKYEFAAGDRGGGNKTGD
GVAAGAAAVVTATGASVSSTDGMRRGTGNAAANQRPVSKRSRAAELEERHVAAPALNLLR
DEKLIEIAGRINEAVSICDLPSLRIELCDLDTVSVTVRQLETTKIGVAVGSILGRKELEK
LWPLSRAIVSSWARAMPVETIEAIKRHQQYRLGKRQDDANKSSTMELSMMSPLAAGAPSF
ADVNDVSGPLALRSVENGERVRMRFVHRVRKLLDNPTDPPIPGVTSSDLEVVAEELCRDV
VEPEDRKHLQEQLEKPGMTQLRRSLATRAMSGKEFLKLPRSALMTEDERRMEEARITKMI
EDQEKLKLANVSVTSLFKCPNCGKNRCSYYEQQTRSADEPTTKFVTCLECKYVWTTE
Download sequence
Identical sequences Q4DEC4
XP_812723.1.87722 gi|71424226|ref|XP_812723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]