SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71649910|ref|XP_813665.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71649910|ref|XP_813665.1|
Domain Number 1 Region: 81-204
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000181
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 12-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000158
Family Glutathione S-transferase (GST), N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71649910|ref|XP_813665.1|
Sequence length 208
Comment elongation factor 1-gamma (EF-1-gamma) [Trypanosoma cruzi strain CL Brener]
Sequence
MSLTLWSGVNAGNTRTHKLLAAATLANVAVTPKTCEYGRENSTAECCRNCSPCGRYPVLQ
TEEGCVFESNAILHHTACIERSGGFLYGLTPLEGSQVDMWLDFSATELDAAPAPFVQHAF
RGGQRLANAMDRVHEVLRALEAWLETRTFLVDECVAVAFAPQWHYRLSGAEGEALTRKYR
NAYRLYNTVMQQPKTVEVLPPSRLCWTR
Download sequence
Identical sequences Q4DH08
gi|71649910|ref|XP_813665.1| XP_813665.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]