SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71651167|ref|XP_814266.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|71651167|ref|XP_814266.1|
Domain Number - Region: 10-65
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00548
Family PWWP domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71651167|ref|XP_814266.1|
Sequence length 862
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MPSATESLRWVKYDDVYYASLIVPDHDAPMPVESGHVFVYFLGTESGAVVPIGDTSPYDP
HDTSRTSHPAAAAGVLVAQQIIAGAEAAAQEELSKGGGEETGGGRRKAKEREIPKKKEKS
GKTKHHRKEDLNALRRRAAEEEEEEMEAEVEEAEEDRVLEKTLSMLNKRSRRNQKERDQE
EEENALLRIDAYRGSKKSHVTVEDEEQDQEQEEEDSKRSNKEVSNEEVEQRNRWDDMAED
LNLTMQSSVGGGRGTHTRSTSKRHADAYPVSLDSGSIVVPFLAEIRHYYRAVLQEAVESD
RIVNLQEAELVRMIESALLQRRGELIYVQQMLQDVEAEYHTVAGGDPSYASDRDTALLEE
AEALRSQLAQLKSSFDIEDMIKKHLHLRDKLPERRERKRPGVAAAGNSTFADASLAFVLD
VQASTAMPRELTQQLAHRYREQRVRRERLLASQHGIGKIGFSAPVTRVMEKWRQSRELMV
LDPRRESQPVSRRYSESLAKVERHAIKCLSAAKGSSNQLFSLYLLQQGQRQPQRASRNLY
NFHEFHEDEEEEARQRQTTAMYQVSSSHPYTPFAGMQNDTDDIAHDTFQAPLISPLRTSF
DPRATFAVDLGEIRQGNTLAEQLAMQSMQYSHSICLPSQESVWENSEVYEGAQRRRTGRP
MSRAGSMSRASSRASSVAREHTDATFKKNSTHRNNNNNSNNNNVKNRNERHSRNDWRASA
KRAILEQLTLYLRGIRGKPTVLNKDQFQFVAKKLLERAVRIESERTGISMSLQANNANAP
FTKDIEARLRKSVDNYVVRHFVTTRTPEPQKRNRGADIGTASMDQWVTSTRDMTRKQEDG
DETRSLMGAYPHSHNSPVYDEW
Download sequence
Identical sequences Q4DIS1
XP_814266.1.87722 gi|71651167|ref|XP_814266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]