SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71652270|ref|XP_814796.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71652270|ref|XP_814796.1|
Domain Number 1 Region: 166-321
Classification Level Classification E-value
Superfamily HCP-like 1.05e-23
Family HCP-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|71652270|ref|XP_814796.1|
Domain Number - Region: 57-104
Classification Level Classification E-value
Superfamily Docking domain A of the erythromycin polyketide synthase (DEBS) 0.0157
Family Docking domain A of the erythromycin polyketide synthase (DEBS) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71652270|ref|XP_814796.1|
Sequence length 325
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MNPSTASTRPNAVACTTHMFHVAKPSVPPKGRGVRRTKEAIPTRAAAVVAPLRRSELEER
LQYLLQAEEELASAVGPNDVMQVLEELRRRRQDRKAVALPRKRLSESLHFICPHVATLVR
ACESTSDEAVVQILREFYQSHYATGGNEKGRSLVSTALAEVLLKRRANENDISEALSMLD
DAVANGHTGAMLLVGLCLRDGIGVPKDLEAALVWVERSADAGYAPAMFELGVMYEDGVED
CGESTLPADWGEAAEWYKGAADRGHTMAQLNLGKLLWKAAALARDAKPDNCDESTIVNLQ
TKSRAWLEMAASSGSEEAVRLLRRR
Download sequence
Identical sequences Q4DK99
XP_814796.1.87722 gi|71652270|ref|XP_814796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]