SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71653497|ref|XP_815385.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71653497|ref|XP_815385.1|
Domain Number 1 Region: 138-212
Classification Level Classification E-value
Superfamily F-box domain 0.0000068
Family F-box domain 0.005
Further Details:      
 
Weak hits

Sequence:  gi|71653497|ref|XP_815385.1|
Domain Number - Region: 196-324
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00127
Family LacY-like proton/sugar symporter 0.061
Further Details:      
 
Domain Number - Region: 403-448
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0426
Family MBT repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71653497|ref|XP_815385.1|
Sequence length 637
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MDYWTRSSNRNSLESIGVTYDERETSPAVNGNVGERARHVQVATPDMSSPPFQSRSNQDR
DWSSFTDELTTTDTTGFTSSSRQLGGLSVHHRDRNLLGFTFSGIPADVVCFRSCISYHSH
RSSKNFVAPEQTGPFAADVLCIILLYIAVDMREILQVSHTCRYWRFYANYAPHWTYYRRT
DWGRRIKDLPRYIRKVVVKPKIVTQEEYFRERRKVQRAQRREEIMGTARHVRWCVAIAFL
SASACTTNFFVAYLLGFFPTVLRNDRSLGTVTFLLMVILVVLEVTVVIVPLGGATSASEK
QNMMRLIAWGLFLLFTACFFGTISSLAMARVQSTGHVISGTVLDFTKETECGVMEAHYNP
SFVLLPTKIADIRWRPITMDDTERKFIPYCISHFNETICYVLLYFDGFYRSNIFNNASAV
VTKDIGTRTALGFDPMDNSTDHWCTIGSRPQVIALTESVYAHVREEVNRYFPDEVYTNPI
LRPQQRGKISYICSMDYARAATEDSPGSTRMWYKHAHPWRRHRIPLSTDITGLSEEFEET
HDHYVHYAFGCYIITSVLWAVMLIMQCFTREQALMVLGVTTTVTLALMNPIIMVLAGALC
VKVPERFFMCNASSGGSLIGGGLFISAVLAALYVCFS
Download sequence
Identical sequences Q4DLX0
psu|Tc00.1047053506753.200 gi|71653497|ref|XP_815385.1| XP_815385.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]