SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71657106|ref|XP_817073.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71657106|ref|XP_817073.1|
Domain Number 1 Region: 11-45
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000017
Family CCCH zinc finger 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71657106|ref|XP_817073.1|
Sequence length 173
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MPKANKHAEVKPSKYRTALCEFYLRQEECPFGTRCAFAHGEHELQTEERNVELLKATGLQ
RLDAAISPTPTRCSAMKAESSLNAVFPVTSLSRRHPVIVSLPCWTESRVVGFERSEPTTP
GKRLDEREAAPSFSFPAREVHRARCSSRFSATCSTEAPVMYRHNPYALSTYYE
Download sequence
Identical sequences Q4DRR2
gi|71657106|ref|XP_817073.1| XP_817073.1.87722 psu|Tc00.1047053506739.99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]