SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71659624|ref|XP_821533.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71659624|ref|XP_821533.1|
Domain Number 1 Region: 111-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.46e-59
Family RecA protein-like (ATPase-domain) 0.0000000393
Further Details:      
 
Domain Number 2 Region: 37-98
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000597
Family DNA repair protein Rad51, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|71659624|ref|XP_821533.1|
Sequence length 351
Comment meiotic recombination protein DMC1 [Trypanosoma cruzi strain CL Brener]
Sequence
MQHAGTRSNKSDTAKDAAHCSDTTSFQEDAAHVIMEVDRLTEQGVATADIAKLRQAGIFT
VAGIHMQCRKDLALIKGLSDAKVEKIIEAARKLFDCGFTNGVTYLQQRGKVTRMTTGSTA
LDQLLGGGIESMSITEAFGEFRTGKTQIAHTLCVTCQLPTSMGGGNGKVIYVDTESTFRP
ERIKPIAARFGLDADAVLNNILVARAYTHEHQMHLLSMVAAKMAEDQFGLLVVDSITALF
RVDFSGRGELAERQQKLAKMMSHLIKLAEEFNVAVYITNQVVADPGGASMFVADPKKPVG
GHILAHASTTRLSLRKGRGDQRVCKIYDSPSLPEVECVFSISEQGIVDARE
Download sequence
Identical sequences Q4E4H2
XP_821533.1.87722 gi|71659624|ref|XP_821533.1| psu|Tc00.1047053506885.310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]