SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71664607|ref|XP_819282.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71664607|ref|XP_819282.1|
Domain Number 1 Region: 521-656
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.02e-22
Family Staphylococcal nuclease 0.0038
Further Details:      
 
Domain Number 2 Region: 340-490
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.22e-19
Family Staphylococcal nuclease 0.018
Further Details:      
 
Domain Number 3 Region: 3-144
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.75e-18
Family Staphylococcal nuclease 0.025
Further Details:      
 
Domain Number 4 Region: 746-767,798-910
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000000144
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 5 Region: 167-298
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000017
Family Staphylococcal nuclease 0.01
Further Details:      
 
Domain Number 6 Region: 715-810
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000226
Family Tudor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71664607|ref|XP_819282.1|
Sequence length 917
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
MSYIVFAVDNADRLTLLGPPTPEGPNLKQIALSFIQAPKLARRSSTGEFGPEEPFAFEAV
ELMRTTFIGKPVKFTEDYVIDVLQRHAGRLELSGGEDASVLLLQNGFATVSEHIPARMEK
TLFAKYSALMNEAKMAKKGIFAPDAASHTRVLRDLTAEETSKLGEKLKGKVVLVRVEQVL
SPTICMVSAEKFPRTQISVRMPGVTIKDSDCLAVSTAARFHTERYLLHRKVKIAFEGWIL
LVHSWLSDFLQGCISTELLLHGFVKINVSTLAFTNHADALRAAEKEAREKRQGLWKNWEE
SGESGTLQVKYGTAAAEAPGLAVNNANSNDGPEYKGPLSFSAVVVQIVNGDTITVRSDEK
GELIRVSLAGVRSSKNVTREQDGRSPETRVSYTDYEWEAREFLRTHYIGKRVIVQVEYAR
QIFETKEVRPVVLVKIPETGANIGLSLLETGYATFLLGKNDVCSEASLLQIAAEKAREKG
LGTYGKGKPPVQKIVELHHLGNARGKYYLSFLQRGMQGNRPPLLKGVVDAVLGGGSLRVY
IPKENFQIPVKVAGIITPMGAANSSETADPFAEESKDFAVTRLQQFNVEIQVHTVDRAGN
FISTVFLPDGTNFSIATVEAGLGTVANADRLPYYQQLIDAEKKAQKEGKYIWSNQSSIPQ
RAAKLMAERNANGVNCYSRSFGPKSEFIPYVLSEVGEDGYSVYLQEQGDENEERLETLQD
LANKVSSLNGEYQPKRGELVVAQYRKDKSWHRAKVLHAKKGEQIVTVLFVDFGTVSETSV
KSVRAIPRGPEFALLRDLEPLARLVRLAFLKSKVPSPEANAGYACDVAYEYTDGAVIAKE
VYQDGQGNVYYTVTVNENVPSLSETLLQRGVALLDRIAESVDPSEYQRHEAAQAIARRSH
KGMWQYGDIDDESDGEI
Download sequence
Identical sequences Q4DY53
gi|71664607|ref|XP_819282.1| XP_819282.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]