SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71744180|ref|XP_803600.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|71744180|ref|XP_803600.1|
Domain Number - Region: 46-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0655
Family EGF-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71744180|ref|XP_803600.1|
Sequence length 141
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MTIVLLCTLLSQLSSFVLRCIPLHRCFLFRFPHLRLVAHMGFKRYPTTVLSICFLSRCAS
TSLSLCICAHTSTGKRCTLFVPGAFIIFSSPVVLYLAQLQFSCVHLCWLQNVAAVSLRTH
EGVVYFSASEQFALWMREEGN
Download sequence
Identical sequences Q38FN0
XP_803600.1.54365 5691.Tb09.160.1600 gi|71744180|ref|XP_803600.1| Tb09.160.1600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]