SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71745272|ref|XP_827266.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71745272|ref|XP_827266.1|
Domain Number 1 Region: 109-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-57
Family RecA protein-like (ATPase-domain) 0.0000000436
Further Details:      
 
Domain Number 2 Region: 31-92
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000157
Family DNA repair protein Rad51, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71745272|ref|XP_827266.1|
Sequence length 349
Comment DNA recombination/repair protein RAD51/Dmc1 [Trypanosoma brucei]
Sequence
MQHVGTRSGKSEAKDAAVSTDNSTHEDAAHTIMEIDRLTEQGVAAADVAKLRQAGIFTVT
GIHMQCRKDLVLIKGLSDAKVDKIIEAARKLSDCGFSVGTAYLQQRGRVTRVTTGSTALD
QLLGGGIESMSITEAFGEFRTGKTQIAHTLCVTCQLPISMGGGNGKAIYVDTEATFRPER
IKPIAERFGLDVEAVLGNILVARAYTHEHQMHLLSMVAAKMVEDQFSLLVVDSVTALFRV
DFSGRGELAERQQKLAKMLSNMIKLAEEYNVAVYITNQVVADPGGASMFVADPKKPIGGH
ILAHASTTRLSLRKGRGDQRVCKIYDSPSLPEVECVFSISEQGIVDARE
Download sequence
Identical sequences A0A1G4IJ11 C9ZYH4 Q38E34
Tb09.211.1210 gi|71745272|ref|XP_827266.1| XP_011776739.1.14543 XP_827266.1.54365 5691.Tb09.211.1210 Tbg972.9.5490 Tb427tmp.211.1210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]