SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71746764|ref|XP_822437.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71746764|ref|XP_822437.1|
Domain Number 1 Region: 19-103
Classification Level Classification E-value
Superfamily RING/U-box 2.79e-36
Family RING finger domain, C3HC4 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71746764|ref|XP_822437.1|
Sequence length 106
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MEEAAAEGMPLSQEQGEQKRFVLKRWNAVALWSWDIEVDTCAICRNHVMDLCIECQASSN
GPRTNCNIAWGVCNHAFHTHCISRWLKTRNVCPLDNKEWSYQKLGV
Download sequence
Identical sequences A0A1G4I5D5 D0A1J4 Q38C61
Tb927.10.1810 5691.Tb10.70.6035 gi|71746764|ref|XP_822437.1| XP_011777402.1.14543 XP_822437.1.54365 Tbg972.10.2190 Tb427.10.1810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]