SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71755957|ref|XP_828893.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71755957|ref|XP_828893.1|
Domain Number 1 Region: 134-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-57
Family RecA protein-like (ATPase-domain) 0.000000023
Further Details:      
 
Domain Number 2 Region: 55-117
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000000581
Family DNA repair protein Rad51, N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71755957|ref|XP_828893.1|
Sequence length 373
Comment RAD51 protein [Trypanosoma brucei TREU927]
Sequence
MNTRTKNKKRTKEVIEDEVHDIDDTAFDDAAVDAVNDNTQEMQQQVGDAAGGPSFRVLQI
MENYGVASADIKKLMECGFLTVESVAYAPKKSILAVKGISEAKAEKIMAECCRLTPMGFT
RATVFQEQRKETIMVTTGSREVDKLLGGGIEVGSITELFGEFRTGKTQLCHTLCVTCQLP
LSQGGGEGMALYIDTEGTFRPERLVAVAERYSLDPEAVLENVACARAYNTDHQQQLLLQA
SATMAEHRVAIIVVDSATALYRTDYNGRGELAARQMHLGKFLRSLRNLANEYNVAVVVTN
QVVANVDGAAPTFQADSKKPIGGHIMAHASTTRLSLRKGRGEQRIIKVYDSPCLAESEAI
FGIYENGVGDVRD
Download sequence
Identical sequences A0A1G4IFQ6 Q384K0
5691.Tb11.01.0360 gi|71755957|ref|XP_828893.1| XP_828893.1.54365 Tb11.01.0360 Tb427tmp.01.0360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]