SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72389402|ref|XP_844996.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|72389402|ref|XP_844996.1|
Domain Number - Region: 24-73
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0511
Family PWWP domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72389402|ref|XP_844996.1|
Sequence length 797
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MAQHSEASDPGSSLRWVLYEDVYYAAIVVPAEEAPVDVPADNQFVYFLGSESGSVVPLTA
VEPFDMNNQERMNHPAAAAGVAVAKQLIMGTGSGENESADGDNEWTARPSREKRTKKGKE
RKATGKKRDGAAVPLKKTRKNARIMDNEDDYTASSSDERNSGTSEGSEESSFSREDEEEE
EGVGLGHWREIEKSLGFTPTSKGKKGSNATKNTSRRGFSSPSERRPGDYVGFFDSCAGSP
VAPFVAEINYYHRKAVDEAKASDCALNLQQSALIRAVEARLVALRAEVLHLRRLIRDAES
ENEEQLETEELKNIRNRIKFLEDSFSVEEIVKQELHMEKITPPQHERKRRRAATQLFSFV
DTSFGYLLDAASATALPRESAAALLDVYGSQKRERERFVASKQGLGKLGLRAPKASVMEN
WRRSREMIVLDPMSDKRPVSRRFSQTLRKVDQRARECYNAASHKTNDIIPRQRRPTTIYN
FNDLRFENERHSESCMEDGVDLVGYNALGLGFNVTTDTAVAIDADADIPVLSPLKTSFDP
RATFIIDASATAPDSLAAQQHGYYSAQCSQTLRLPSQESLWGRSEVPDAAGCDATMASQH
MRSISRTGRSLSRAGSMSRASSRASSVMWDATSGTSRKHGRSNASSVARGSRNAGDWRSS
AKRVILEQLTLYLRGLRGKPAVLNKEDFSHTAKELLGRALKAESKRKGISLSLQATNLRA
TLEKDVETRLRKSVDNYVLRHFVNNQVPNRHKSVDIDSGSHASKHRSETRRREDDGEENR
TTIINEDRETDSPVYDQ
Download sequence
Identical sequences A0A1G4I0I3 Q57Z69
5691.Tb927.5.3240 gi|72389402|ref|XP_844996.1| Tb927.5.3240 XP_844996.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]