SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72390213|ref|XP_845401.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|72390213|ref|XP_845401.1|
Domain Number - Region: 315-375
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0662
Family Tudor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72390213|ref|XP_845401.1|
Sequence length 880
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MSARNKMGLEQAGSAVPSSTSGYVSTSRHSKTSESRRSGDRQVVRGMDSVRSFFSRNCKP
AEVNKPSSCRRRALQTSLPVEGGNTTRGEIVAKSLDSWITKRPASASASHEVPAKVPDKR
RFIRLSQSSLSSIMTDQSLVTQPLLDTPEGYDHTAGLRVESESGDLVSACTQRPVKNSHC
VSPSLRCSNVGEPHLSISKQLTDDKCRIGKHNGSTKYMNNVVSSLPISIYSSPETFSCSN
EATQQSNGKEGKVKAEKRPRPQMSPGQHTSMCSADQNQMAVSNDREMDERERLGTEPSNK
LELPRGVLGIEGILSFEENPALARADFNVGLRVLVQREGEWLFATVVSREENGYVDVCLE
GNGTTIRSTTSNLRVDEAKTGSSTERKISSGKDEKCAPLVSSPKQTNLEVIGMSEATSPN
LTAPEKTQTGPCEEVSSKRVHPSVILMYVSPTVGERLGKDALHVLRNLTKSGTTLVDSPQ
KLQGASQRIMSAKEQYGVPQQCGKHLWGICFVLVSGTAEHYAREVRIIDEAHAVGISAVS
LKWLERLHNEGSWNASSVSLPYPEELMDQNDGGVFRCSLLREAERTLRQHLVYIPIADPD
IENLIELSGGKVTRTLPPNKQNCPGPSDPHWIYVKDGNQNPLRTSHPSIKTLSLERLRKR
IHSYFATLPSSFSGQDDCTCFDVKADGTLVDKCLKTQDDENTASDGETAATKMGGEEHDF
TLFARPCDYPTREEPKILPGEDYYFRLPRGDDREGQINQAFPVAMGRVLNVNGSSAHGRT
VTMQLYRITRVYHVQDPQTGSITSRQCVCLGPETVSVMESDLIFDTGPFVFPLEAMQHLY
ILEQQQDCRDGASAGPPASPWNSQFSTMAPRPTQFRHRYS
Download sequence
Identical sequences Q583Q4
XP_845401.1.54365 5691.Tb927.6.2800 gi|72390213|ref|XP_845401.1| Tb927.6.2800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]