SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72390611|ref|XP_845600.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72390611|ref|XP_845600.1|
Domain Number 1 Region: 426-494
Classification Level Classification E-value
Superfamily RING/U-box 0.0000628
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Weak hits

Sequence:  gi|72390611|ref|XP_845600.1|
Domain Number - Region: 3-54
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000403
Family PWWP domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|72390611|ref|XP_845600.1|
Sequence length 530
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MPYPLGSSLWVKCDDGEWWPATVREVETELLLSMGSEYDTCIEFYHDPGNFYPLDSTSGG
VRLLHLAVEERDKDEQRLFNVSATKEAVRRLLEERSGTPTASPTEDSQPYSAAEMRYMRS
LVDSVSPDSAAVMQNSLKQEGVNISRRNIRRVARKERSSKSKVSRSRTSVEERSTVRLTS
SLGSTQSSKSTNPTPPLSCGRSSSSWRRRSGGRGGVEVYGECVFQEAVDAATLDVLRAEV
FGNPDRFVLSPLYRFLDVLGAVSVEGESIETTLPSPAAVNEEPPQGFSPSRRVLLVPLSS
SSYNHTDGWLESFEFENKRIAMELFVNGLKVVTPPNPSVPSGRESVAVKTTPVADITEMV
SGKELFSLRVHFTGLMEDATLWEGYIVAVYVERTGVDLLAERIVSNYHSSPAQREVEGVV
DVQVRAVCPITALPLSVPVRACGCEHVQCIELQAVLMHCDRTNVWNCPLCWAPMTPETIA
VNYRLKEWLDSNRSRVNKVDFIVETPPGRNLNVVWRKNEPRKIDNIETLE
Download sequence
Identical sequences A0A1G4I4L5 Q586F5
gi|72390611|ref|XP_845600.1| 5691.Tb927.6.4830 Tb927.6.4830 XP_845600.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]