SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72391162|ref|XP_845875.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72391162|ref|XP_845875.1|
Domain Number 1 Region: 170-234,279-361
Classification Level Classification E-value
Superfamily YaeB-like 6.67e-41
Family YaeB-like 0.00034
Further Details:      
 
Weak hits

Sequence:  gi|72391162|ref|XP_845875.1|
Domain Number - Region: 49-80,107-119
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000102
Family PWWP domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72391162|ref|XP_845875.1|
Sequence length 391
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MEESTERSLIRVDSHRDSQPEPVEDAHGEDVVLKGGKTRPRPMRFGVRPHYFLPNDIVWI
RPPGLPYWPGEVLVADVKSNRITARLFDPPPSLVSSGDADDGLKRDCITAPASAVYFFDR
LRTPEDVADCIEQRLQRTKHKVDAYEAAFHRAVMHANRLVRIVLSPEKLQPYSICGVGIV
YSLMRTHISAPRQPHTENFMPQTAVIRLRVGLENAVRDLKGFEYIWVLFSFSYALPVDEE
CTQAKDSATAADDTGGVKGDRAEVAVGAKRQRPRQGAERSAGFKTMLVPPRDSELRGVFA
TRSPHRPNFIGLSCVRLVDVRGLEVHIADHDLLHGTPVLDIKPYLPFCDAHPDAYAGWVA
ELDAAGRGGSDHKYDKQSLQVDRVFEEEAVA
Download sequence
Identical sequences A0A1G4IA11 Q57XM2
Tb927.7.2520 5691.Tb927.7.2520 gi|72391162|ref|XP_845875.1| XP_845875.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]