SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73536722|ref|XP_847780.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73536722|ref|XP_847780.1|
Domain Number 1 Region: 17-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-26
Family Glutathione peroxidase-like 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73536722|ref|XP_847780.1|
Sequence length 145
Comment tryparedoxin [Leishmania major strain Friedlin]
Sequence
MSGVAKHLGEALKLRKQADTADMDSLSGKTVFFYFSASWCPPCRGFTPQLVEFYEKHHDS
KNFEIILASWDEEEDDFNAYYAKMPWLSIPFANRNIVEALTKKYSVESIPTLIGLNADTG
DTVTTRARHALTQDPMGEQFPWRDE
Download sequence
Identical sequences E9ADX4
gi|70799656|gb|AAZ09572.1| gi|73536722|ref|XP_847780.1| XP_003722195.1.98313 psu|LmjF29.1160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]