SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|74025818|ref|XP_829475.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74025818|ref|XP_829475.1|
Domain Number 1 Region: 528-665
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.79e-22
Family Staphylococcal nuclease 0.0015
Further Details:      
 
Domain Number 2 Region: 5-143
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.62e-18
Family Staphylococcal nuclease 0.018
Further Details:      
 
Domain Number 3 Region: 172-298
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 9.42e-16
Family Staphylococcal nuclease 0.0097
Further Details:      
 
Domain Number 4 Region: 344-493
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000183
Family Staphylococcal nuclease 0.012
Further Details:      
 
Domain Number 5 Region: 718-796
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000102
Family Tudor domain 0.0066
Further Details:      
 
Domain Number 6 Region: 758-775,806-917
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000017
Family Staphylococcal nuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|74025818|ref|XP_829475.1|
Sequence length 924
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MSFLVYAVDGADRLTLLGPPTPEGPNLKQVALSYIQAPKVAKRNATGEFGSEDPCAFEAV
ELIRNTFIGKPVKFSEDYVIDVLQRRAGRLTLVDGEDASILLLRNGLATVPERIPQRMDK
ELFAKYTKLMSEAKAAKKGIFAPSASSRVRTLTDLSPEEKIKLAEKLKGKEALVRLEHVL
LPTVLVVSGGDFGDAQVTVHMPGVTVKDPDCETVSRESRYHVERFLLHRRVKILFEGADG
YGNILGSVTSSKGCFQQELLSRGLVKLNGNTLGSTKFAADMETAEKEAREKCVGMWKNRG
ESGARVPLKVVGGAGVSTAAATGGSSALPVSNAATAATVVYKGPTQFTASIVQIITGDTL
GVRHEESGELIRVSLAGVRSSKNITREQDGRSPETRVTYGDYEWEAREFLRVHFAGKRVT
VKVEYCRQIAETGEVRPVALITVLETGENVGSALLETGYVNFFLGRNDICSAAAELQCAS
ERAEAKGVGVHGKAPAPVVKVLELVHLGSARGKYYLSFLQRGMQGNRPPVLKGIVDVVIG
GSSLRVFVPREHFQIPVKVAGIITPMGAAGGSSEGGEPFAEESKRFAVDKLQHMEVGIQV
HAADKVGNFISSVTLPDGTNFAVAMVEMGFATVANADRLPHNQQLLEAEAKAKAEKRNIW
SNNSSVPQRAAKLEAQKIRTGPIRYTSSSGPKAEFQQYMLSEVGENGYSVYLQEATEDVE
KKLFTMQDLLGQISSSSTEYKPKKGELVAALYKTDKTWNRAKVVQVSKKDPTVTVCFVDF
GTKSEIRLKDVRAIPRGPEFAIARDSAPLARLVRLAFLKSKIHTEAYIDYACDIAYEYTD
GPVVAKEVYQDPEGNVYCIVSTSENSNSLNEVLLQRGAAVLDRAAESVDPEGHKRHVTAQ
NVARKGHKGMWQYGDIDNESDEDN
Download sequence
Identical sequences Q382B8
XP_829475.1.54365 Tb11.01.5780 5691.Tb11.01.5780 gi|74025818|ref|XP_829475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]