SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82539154|ref|XP_723988.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82539154|ref|XP_723988.1|
Domain Number 1 Region: 113-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.42e-59
Family RecA protein-like (ATPase-domain) 0.0000000218
Further Details:      
 
Domain Number 2 Region: 43-98
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000816
Family DNA repair protein Rad51, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82539154|ref|XP_723988.1|
Sequence length 352
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MPAMKSANAKEDTISQTCDNSTTEDVDEHLYTGPLKIEQLLAKGFVKRDLELLKEGGLQT
VECVAYAPMRTLCSIKGISEQKAEKLKKACKELCNSGFCNAIDYHDARQNLIKFTTGSKQ
LDALLKGGIETGGITELFGEFRTGKSQLCHTLAITCQLPIEQSGGEGKCLWIDTEGTFRP
ERIVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADTRFALLIVDSATALY
RSEYTGRGELANRQSHLCRFLRGLQRIADIYGVAVIITNQVVAKVDAMSMFGGHEKIPIG
GNIIAHASQTRLYLRKGRGESRICKIYDSPVLPEGEAVFAITEGGIADYEEK
Download sequence
Identical sequences Q7RI44 V7PGL4
gi|82539154|ref|XP_723988.1| 73239.Q7RI44 1118.m00048|PY03786|PY03786|Rad51 XP_723988.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]