SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82752559|ref|XP_727350.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|82752559|ref|XP_727350.1|
Domain Number - Region: 441-530
Classification Level Classification E-value
Superfamily MTH1598-like 0.0706
Family MTH1598-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82752559|ref|XP_727350.1|
Sequence length 1116
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MASDMVHIMNKSKELGEIFMNYFNNDALSIKYINDCKNGDSLELYGCFYFVNSDSIRNRG
GGQNSESGDFIENITFLSFCYMNKLIEKYYNNYNYGDKINIRNNFINVLFGLSLEFNHSI
NMDILNIKEKSLELFKKKLMEIFINENNNYLMSNFMNCSDCYLIRSYSNSTKNKYSQILS
IICMYNDYTYFRYLYNFILYFIVIFLKKKMEYIALPGKNQDPMELRQKIYEMFFKQENEV
KNKNEYFSALLHISINFLKEIFYTITNDSFTNILTRHQFNTFRTIIINDINEFFNFIYTC
FYYFILLKKKNEFILLMECIKELSFFSPIYLFFTSSYISPINFLLNVLVMPLRNENSVNS
VNNENSVNNENSVNNENSGNSENSENSENITFLSPDGFNCLYTRYIYRQGQNMESIEFSN
LNKCINNFVSDSNLQEIILTTFSNIIEGVSKINNKTFFQINENELMNFLENFFNIDLNYY
DIKHYNFENVYINMIMSLSAIPISNYIHKKENQIKCINIYMISIFKNIHHPNVNILINIL
IICKNIFEKNRDLIFVKNNQLDQIQNEQNNIYKLEKNALLDDDNAKKYNQNLFIISIEDL
KKLFILMYIRYIKIPTYKDSNSLNKKFMLHFFNSYITEYNEDWFDAYYKYAIHEINNDDI
NFQFETCSNIMTKDNNTSFNNILRQRICLLMKTIISMNHEVYQIAINVFSDLFKFYNNIN
VDNLFKETNKCKDYFIYSLLEMYYEMLTFLINTLKDCKNIIMEANHKIHEDIISYQLSTS
TTDSNNENWAKNQYVQNKNNMLNCIDHEIDKLVTFERENEKIKLNKMGGDKNGNKINFEN
KLDGGENKLDGGESEDIKILREEKNRINLVLHIIKCINKYKSSPYYEIDNNCINNLLTCY
KKISENDFINFISISKNLIMFEIKRLEFISENSYILNYTKEYAFFMMENLFKIILQNDNN
ISFELKKNYFSIFSSIIENLKNHLTNDVIHNILKTFLECKKSITSMGSENESIFSTSTFK
HNKEFSIFILVLISSLNVDNINDNIEYIQIIMNGSIEFLNNLNKQVTNFQNLYNFLYTDK
NSLTKVEYLFDTYKIVQDFFSQFSYKKIEKKIXQKN
Download sequence
Identical sequences Q7RA41
gi|82752559|ref|XP_727350.1| 2293.m00018|PY06664|PY06664|hypothetical 73239.Q7RA41 XP_727350.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]