SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82915052|ref|XP_728954.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82915052|ref|XP_728954.1|
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.31e-22
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 2 Region: 596-643,679-765
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.48e-16
Family Staphylococcal nuclease 0.0075
Further Details:      
 
Domain Number 3 Region: 363-447,517-566
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000000222
Family Staphylococcal nuclease 0.0083
Further Details:      
 
Domain Number 4 Region: 812-908
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000354
Family Tudor domain 0.0055
Further Details:      
 
Domain Number 5 Region: 165-187,236-353
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000288
Family Staphylococcal nuclease 0.019
Further Details:      
 
Domain Number 6 Region: 861-1009
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000000129
Family Staphylococcal nuclease 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82915052|ref|XP_728954.1|
Sequence length 1013
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MERLVGVVKQVISADTYVLLGPKKNGIAQERQVSLACIQCPKLYVKSQTSEKNEEPFAWE
SRELIRKIIIGKNVSFTLEYVYNNRQYCSVYFEDTNLSILLLEKGYANLVFNKNVKTNVY
GDLEPYYLEAKSKNLGIFGNNINNFVRNIININNDKNENKKIYDMLVNKKVHCVIEHVRD
GGHLRVYAQLEKNENKDEGNKKNNVKNESKKNDKGGKGAKKKNEDNTISQTGEKYLTMYY
FSISLCGIIVDMYKKEVINNVETIKEETYATETKKFVEYRLLNRDVEIEIKHIDNNLNLY
GNIYYKLGNICLLLLKNGYAYINDYTIKYVENPLEYKKALDEAVKLRKKKWINYSEKEVD
FEKEYITTVIEILYGDIIIVDYKNEERRLYLSSIKCEKHNSDIHLNTLSLLAKDYLKKKI
VGEQVKIVTECVKTPQSNNEGYIPPCSDNKGRMHFVSVYQINKKQVDKKGNVPGSDKINS
EIANKDNSGKKKKGKKSNNNTKDDKKNESENMDQENYNEISLNEELVAEGLAKVVNYVQE
NEKPDYYFNLQALEKEAEKKKLGRFNPHLDIIKINNISGSENALRARSFENTLNKYNNLN
AYIDYIYGANKYKIYIPSQNLMINFILLGVNIQKINLKEIGNENVNKNGNIENGKREDDY
VAGDTGKKNNKKEKSEYRDIAIQAYKYVRRLLMQRAVQICIITCDKGGNFIGTLKYQNKD
IAQDLLSLGYGMLNDIGLKNITERSNYIKASEEAKNNKRNIWAIEVINENNENNLISGDK
AKLSEFDNIYYCSYVDDINNICLQLKNKQDQLKKFQEDINKKSYIESIPEISINNINKNT
LVLAKYIDNYYYRAVILQINKSKNKCIVKYIDFGNEDEINFADIKKLTPEYSLKNYHQFA
IKVALSGLKMPEDNKPDLMIYIKQLLLDKFLYVKFEKKVENIYHVVFYDYEQFTTNKNVK
SVNEEIANQGICYVDNFSDTKIFEKLKKEELQSKKNKLGIWSYGDINYDDNYA
Download sequence
Identical sequences A0A078K7Q1 Q7RQ75
XP_728954.1.76580 gi|82915052|ref|XP_728954.1| 321.m00093|PY01228|PY01228|Unknown 73239.Q7RQ75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]