SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|84043614|ref|XP_951597.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84043614|ref|XP_951597.1|
Domain Number 1 Region: 419-467
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000191
Family Transcriptional factor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 167-246
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000536
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|84043614|ref|XP_951597.1|
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000536
Family PWWP domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|84043614|ref|XP_951597.1|
Sequence length 467
Comment transcription elongation factor S-II [Trypanosoma brucei TREU927]
Sequence
MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKA
TYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDKESNALRFEPTHSKNTAPRGT
SQRAFSTSGRAGSLNNATQQTAGGKRSREVSRMRQRSTGSHLSPASDDALVQWKKDIDEA
TDNCDGALLTSTLLKLASVSVTLRQLLRTKIGVSVSRALSKKDLEEQRSLATCIISAWTA
KLPEETVRAIEEYNKYEQEAKKRGGTARSGGARHNKRRGTISSSQTREERDVATPSTSES
VGNPITIGGGAQPQFVDRVQKLLLQPGDPHSFSVRSDDLRSVAEKICAEVTRSEDRMYLL
EHLSKPGLSEIRRRLAMGELSGKDFLELSRWELMTQEEKEDAERRTTEKLRNLEETERSL
LHTTSLFECPECHGRECEWRELQIRSADEPTTKFIKCIKCKHNWSEN
Download sequence
Identical sequences Q586X9
gi|84043614|ref|XP_951597.1| XP_951597.1.54365 5691.Tb927.2.3580 Tb927.2.3580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]