SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|84996361|ref|XP_952902.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84996361|ref|XP_952902.1|
Domain Number 1 Region: 104-279,306-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.24e-56
Family RecA protein-like (ATPase-domain) 0.0000000326
Further Details:      
 
Domain Number 2 Region: 28-87
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000000000091
Family DNA repair protein Rad51, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84996361|ref|XP_952902.1|
Sequence length 369
Comment DNA repair (Rad51 homologue) protein [Theileria annulata strain Ankara]
Sequence
MSSDELSLVKEENSMGVSESGSQNPQRLECLLSKGLLQRDLDLLREAGYSTLECVAYAPQ
KNLLVIKGLSEQKVLKIKAACRELCHLGFCSGQDYLEARGNLIKFTTGSSQLDKLLQGGV
ETGSITEIIGEFKTGKSQLCHTLAVTCQLPVEQSGGEGKCLWVDSEGTFRPERIVSIAKR
FGLSPSDCLDNVAYARAYNTDHQLELLVEASAMMAQTRFALLIVDSATSLYRSDYSGRGE
LASRQMHLCKFLRALQRIADTFGVAVVITNQVVARVDAMSTFFGILLLYIIIYCYILINI
CKFYIDKFVGNDKLPVGGHIIAHASQTRLFLRQSKGESRICKVYDSPVLPEGEAVFAITD
GGINDYHDR
Download sequence
Identical sequences Q4UA75
gi|84996361|ref|XP_952902.1| XP_952902.1.9581 TA07350 5874.Q4UA75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]