SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|84997237|ref|XP_953340.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84997237|ref|XP_953340.1|
Domain Number 1 Region: 153-213
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000444
Family Tudor domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|84997237|ref|XP_953340.1|
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0277
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84997237|ref|XP_953340.1|
Sequence length 284
Comment hypothetical protein [Theileria annulata strain Ankara]
Sequence
MDEAETIDDLKANLDEYQKQLATVEDSLKQDPENQELISLKRDLNEVIILTNDLIKYKQS
NEGILLFVKVFLELLKQGVIHLEDIKDVDITTSIFIGRTCVVLYNGKQKYGEVVQVMGDQ
PNDLTVIELLGSREKCSLCLKDLRLLEPPLPAQCKPGSLVQALYGEDGYEDGYIYLFRRW
YDCIINRQTEKGYIVTYKDYNTSEEVQRDRVKTKIKEVKEIVTPAGYVIPENLIIKKTDN
EKEKLRKRKLVQTLKKQQKSQKEDEESYKRASNWRKFQKKVTNF
Download sequence
Identical sequences Q4U8Y8
gi|84997237|ref|XP_953340.1| TA10430 XP_953340.1.9581 5874.Q4U8Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]