SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121881495|gb|EAX87523.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121881495|gb|EAX87523.1|
Domain Number 1 Region: 288-572
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-108
Family Ankyrin repeat 0.0000164
Further Details:      
 
Domain Number 2 Region: 126-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000196
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121881495|gb|EAX87523.1|
Sequence length 573
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MSNQDIHPNKYSELRNTHKYYIDIYNSLYQLKSEKEEELKSIFKMIKTELIESNKHPPKD
IIKDILKIIPYNNRYTKSYLFLAKLFSDEYHVEEVKGISDISNILFYKEHGIKIDKSFDF
EKDDFENLDIHTENTIYRAIMNNDLEKFITFTGIDGFDKDQKLKSDLYPDSYEGYSLLEL
CCYHGAVDCFKFLRTKFNSEITQRCLELSFLGGNKEIMSECFKYQKPNEKCMEYAIISHN
IDFVTFLMNEYNIDIDLEICGFYNNLESFLVYFDQTNDINKCFVYSPIIGITSLTEYFIS
HGANINEKNNNGETALHIAALYNSKEIAEVLISHGANINEKDKNGDTALYYAAYNNSKET
AELLISHGANVNEKDQNGETALYYAAYNNSKETAELLISHGANINEKDQDGETALHKTAR
NNSKETAELLISHGANVNEKDQDGRTALHKAARNNNKEIAEILISHGANINEKDQDRETA
LHKTARNNSKETAELLISHGANINEKDQDGRTALHKAARNNNKEIAEILISHGANINEKD
QDRETALHKTARNNSKETAELLISHGVNINEKK
Download sequence
Identical sequences A2G5Q1
89557.m00034 5722.A2G5Q1 gi|121881495|gb|EAX87523.1| gi|123393764|ref|XP_001300453.1| XP_001300453.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]