SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121884587|gb|EAX90295.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121884587|gb|EAX90295.1|
Domain Number 1 Region: 141-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-92
Family Ankyrin repeat 0.0000335
Further Details:      
 
Domain Number 2 Region: 37-109
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000471
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121884587|gb|EAX90295.1|
Sequence length 418
Comment ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Sequence
MDNDKELLISIIEKSEFDKDQRLDDTFYPYSLKGYSYLELCCYYGSVDCFKFIITKFHPE
ITKKCLRFSFLGGNQEILSECLKKQEPDKKCMKIAIITHNIDFVSFLRNEYDIEIDLADC
GLYNNLQSFLVYLDQTNNIDTCLIYSSYFFLPSLIKYFISHGADINARDKNKRTPLHNAA
YSNSKETAEVLISHGADINARDKNKETPLHKAAYSNSKETAEVLISHGADINARDKYKRT
PLHKAAYSNSKETAEVLISHGADINARDEDEKTPLHNAAYSISKETAEVLISHGADINAR
DEHEKTPLHYAAYSNSKETAEVLISHGADINARDKYKETPLHKAAFSNSKETAEVLISYG
ADINARDEDEETPLHYAAYSNSKETAEVLISHGADVSDNDSDDDNDRDDDNDSYDDSY
Download sequence
Identical sequences A2FXT4
89292.m00038 5722.A2FXT4 XP_001303225.1.43485 gi|121884587|gb|EAX90295.1| gi|123408578|ref|XP_001303225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]