SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121889584|gb|EAX95000.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121889584|gb|EAX95000.1|
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.76e-20
Family Ricin B-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121889584|gb|EAX95000.1|
Sequence length 237
Comment QXW lectin repeat family protein [Trichomonas vaginalis G3]
Sequence
MNCYFINAAHPEYLLTIGDKSTKTREGQLIIWKYEKGLQNQFMIFKERMVNALSGHLLEP
FSKEKGSIVVQDSVYKRQEKWHYYPDMTIRNSAGYVLDVQGGRFEEGTPIILWNNNGSQQ
QKWIFCTVLKTGRKVHHHHHHHHRSHRTSSTTVKRTTTTVTIVETKEVPAEETQDKSFFQ
KVAEKVSEGLSTSSESDDDKEHVEETPSPAGKKHRKKKHHTGEQHKHRKHHSKESQD
Download sequence
Identical sequences A2FJD9
81933.m00069 5722.A2FJD9 gi|121889584|gb|EAX95000.1| gi|123430728|ref|XP_001307930.1| XP_001307930.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]